Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER139C  from Saccharomyces cerevisiae S288C
>YER139C|YER139C RTR1 SGDID:S000000941, Chr V from 451243-450563, Genome Release 64-1-1, reverse complement, Verified ORF, "CTD phosphatase; dephosphorylates S5-P in the C-terminal domain of Rpo21p; has a cysteine-rich motif required for function and conserved in eukaryotes; shuttles between the nucleus and cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (226 aa)
MATIEDIKETALIPFQKHRQLSMHEAEVITLEIIGLLCDSECKDEKTLKYLGRFLTPDMY
QDLVDERNLNKRCGYPLCGKSPERIRDPFSMNDTTKKFLLENNPYAYLSHYCSKFHFRCS
QFYQVQLSDEALFARTGVHLFEDPEQDKHDIDFKVTLFEELLREKASEEDIKSLISGLKK
LGLNPDSGTTEKDDTELEDDLSKWLAQIKIVENDNPSILGDFTRED