Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER134C  from Saccharomyces cerevisiae S288C
>YER134C|YER134C YER134C SGDID:S000000936, Chr V from 437803-437267, Genome Release 64-1-1, reverse complement, Verified ORF, "Magnesium-dependent acid phosphatase, member of the haloacid dehalogenase superfamily; non-essential gene" ORGANISM: Saccharomyces cerevisiae S288C (178 aa)
MTGYPDVAAFDLDYTIWPCYCDTHLHGPFKPVKSSNGEVLTIICRDGYELTIYKDIPRIL
GDLKDNGVKLMTASRTWAPEIAQEILKIFKVKYAGVVTPLANLFDEFQWGERSKIGHLRD
GLKDLYNTSDLKSKKICLFDDESRNKEVEKYGVKFVYVRDPENGPSWKLYQDYLSGKV