Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER131W  from Saccharomyces cerevisiae S288C
>YER131W|YER131W RPS26B SGDID:S000000933, Chr V from 423952-424311, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Ap and has similarity to rat S26 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (119 aa)
MPKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYP
EYALPKTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQRPRFNRDNKVSPAAAAKKAL