Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER121W  from Saccharomyces cerevisiae S288C
>YER121W|YER121W YER121W SGDID:S000000923, Chr V from 402375-402719, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; may be involved in phosphatase regulation and/or generation of precursor metabolites and energy" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MGLSRWHDKNSRPAEEKSEEMQQDAHYYALAASDSLNASVSNEYGNQVMNSFWKVGIDSP
YVDDEAIRNRDVENNLPSLKQSVYNANEPNATSSAFSTASYAHETFDFRNLKLR