Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER117W  from Saccharomyces cerevisiae S288C
>YER117W|YER117W RPL23B SGDID:S000000919, Chr V from 396769-396810,397282-397653, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl23Ap and has similarity to E. coli L14 and rat L23 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (137 aa)
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMA
TVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGK
ECADLWPRVASNSGVVV