Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER093C-A  from Saccharomyces cerevisiae S288C
>YER093C-A|YER093C-A AIM11 SGDID:S000002960, Chr V from 348201-347912,348400-348277, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function; null mutant is viable but shows increased loss of mitochondrial genome and synthetic interaction with prohibitin (phb1); contains an intron" ORGANISM: Saccharomyces cerevisiae S288C (137 aa)
MIEEKKELKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKYVPSIFQQNYKLPPFSQRN
EAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMSLPQALETDTSMDEET
SKLTKQLQDLLSSENNK