Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER087C-B  from Saccharomyces cerevisiae S288C
>YER087C-B|YER087C-B SBH1 SGDID:S000002128, Chr V from 332830-332582, Genome Release 64-1-1, reverse complement, Verified ORF, "Beta subunit of the Sec61p ER translocation complex (Sec61p-Sss1p-Sbh1p); involved in protein translocation into the endoplasmic reticulum; interacts with the exocyst complex and also with Rtn1p; homologous to Sbh2p" ORGANISM: Saccharomyces cerevisiae S288C (82 aa)
MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFL
AVGFIFSVVALHVISKVAGKLF