Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER074W-A  from Saccharomyces cerevisiae S288C
>YER074W-A|YER074W-A YOS1 SGDID:S000007651, Chr V from 307653-307746,307849-307956,308068-308123, Genome Release 64-1-1, Verified ORF, "Integral membrane protein required for ER to Golgi transport; localized to the Golgi, the ER, and COPII vesicles; interacts with Yip1p and Yif1p" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MVLFGLGRLFYVILLLINAVAVLSEERFLRRIGLGRSNDETPVFGQDQNTTKSKVVQLIG
AVQTLLRIPLIGINILVIVYELLLG