Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER074W  from Saccharomyces cerevisiae S288C
>YER074W|YER074W RPS24A SGDID:S000000876, Chr V from 306323-306325,306792-307196, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (135 aa)
MSDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGF
RTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFG
TGKRLAKKVARRNAD