Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER072W  from Saccharomyces cerevisiae S288C
>YER072W|YER072W VTC1 SGDID:S000000874, Chr V from 302806-303195, Genome Release 64-1-1, Verified ORF, "Subunit of the vacuolar transporter chaperone (VTC) complex involved in membrane trafficking, vacuolar polyphosphate accumulation, microautophagy and non-autophagic vacuolar fusion; also has mRNA binding activity" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MSSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLGGLGVGLLNFGDKIGRV
SAGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRL
KYNDANTKL