Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER071C  from Saccharomyces cerevisiae S288C
>YER071C|YER071C TDA2 SGDID:S000000873, Chr V from 302327-301947, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern; null mutant is sensitive to expression of the top1-T722A allele" ORGANISM: Saccharomyces cerevisiae S288C (126 aa)
MSMQIEIKDGRSDNSPLPERKLVTLIQESYDSLKDDNEINLSTESTSNLLIKLVLEKLEK
HSSLYKYIASVTTLNIEGLNEENANFSLKNDIGASWESKKDGIFNYKLEDKNNNECYLIT
ILWLHK