Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER067W  from Saccharomyces cerevisiae S288C
>YER067W|YER067W RGI1 SGDID:S000000869, Chr V from 292066-292551, Genome Release 64-1-1, Verified ORF, "Protein of unknown function involved in energy metabolism under respiratory conditions; protein abundance is increased upon intracellular iron depletion" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MTKKDKKEVKVQTVTTEDGETVKVFEDLQGFETFIANETEDDDFDHLHCKLNYYPPFVLH
ESHEDPEKISDAANSHSKKFVRHLHQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKIT
WHYGEETEYHGRPFKIDVQVVCTHEDAMVFVDYKTHPVGAN