Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER063W  from Saccharomyces cerevisiae S288C
>YER063W|YER063W THO1 SGDID:S000000865, Chr V from 281710-282366, Genome Release 64-1-1, Verified ORF, "Conserved nuclear RNA-binding protein; specifically binds to transcribed chromatin in a THO- and RNA-dependent manner, genetically interacts with shuttling hnRNP NAB2; overproduction suppresses transcriptional defect caused by hpr1 mutation" ORGANISM: Saccharomyces cerevisiae S288C (218 aa)
MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQEQNQEQGSEP
AAIEEPASQNITEKKEVSSEPKETNEPKEENKDVQKPSDGPSATASENEQAAASTAAPAL
SPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGLVSR
KNEPESGNNGKFKNRNKNANNRSRVSKNRRGNRSGYRR