Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER057C  from Saccharomyces cerevisiae S288C
>YER057C|YER057C HMF1 SGDID:S000000859, Chr V from 271126-270737, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the p14.5 protein family with similarity to Mmf1p, functionally complements Mmf1p function when targeted to mitochondria; heat shock inducible; high-dosage growth inhibitor; forms a homotrimer in vitro" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MVTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNI
KNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDME
MEAIAAERD