Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER056C-A  from Saccharomyces cerevisiae S288C
>YER056C-A|YER056C-A RPL34A SGDID:S000002135, Chr V from 269751-269423,270185-270149, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl34Bp and has similarity to rat L34 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (121 aa)
MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR
QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVKKVVKEQTEAAKKSEKKAK
K