Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER053C-A  from Saccharomyces cerevisiae S288C
>YER053C-A|YER053C-A YER053C-A SGDID:S000007523, Chr V from 261046-260933, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum" ORGANISM: Saccharomyces cerevisiae S288C (37 aa)
MQDLEIFLSIFAFIFVFYFGAHRTVMNRNKSDVPYLQ