Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER050C  from Saccharomyces cerevisiae S288C
>YER050C|YER050C RSM18 SGDID:S000000852, Chr V from 254387-253971, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the small subunit, has similarity to E. coli S18 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYDPFDF
SMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAK
NQRRLSKAIRRCQAIGLM