Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER046W  from Saccharomyces cerevisiae S288C
>YER046W|YER046W SPO73 SGDID:S000000848, Chr V from 243180-243611, Genome Release 64-1-1, Verified ORF, "Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensible for both nuclear divisions during meiosis" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MGKNHFLKDFSALPEDVLIENERGITLLGYPLFSPKILLPHVDPPQFQRLNTENGSLIAL
SKNTISNFIELYPIDLSTERTAGSSSSQMTKWFVLMDYKEKYDIDDQGWCYSWNFNNSRW
KSKNGLVRRRVWVRLPTTSHGLD