Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER044C  from Saccharomyces cerevisiae S288C
>YER044C|YER044C ERG28 SGDID:S000000846, Chr V from 238016-237570, Genome Release 64-1-1, reverse complement, Verified ORF, "Endoplasmic reticulum membrane protein, may facilitate protein-protein interactions between the Erg26p dehydrogenase and the Erg27p 3-ketoreductase and/or tether these enzymes to the ER, also interacts with Erg6p" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTET
THLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGK
GFMGPLVVSTTSLVWMYKQREYYTGVAW