Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YER039C-A  from Saccharomyces cerevisiae S288C
>YER039C-A|YER039C-A YER039C-A SGDID:S000007226, Chr V from 229481-229263, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; YER039C-A is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (72 aa)
MSKHKHEWTESVANSGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVT
LCILRIVGVANF