Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER035W  from Saccharomyces cerevisiae S288C
>YER035W|YER035W EDC2 SGDID:S000000837, Chr V from 222639-223076, Genome Release 64-1-1, Verified ORF, "RNA-binding protein, activates mRNA decapping directly by binding to the mRNA substrate and enhancing the activity of the decapping proteins Dcp1p and Dcp2p; has a role in translation during heat stress" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MGSETKHSAKVKIVTRESPPSAKEHMRPTKTQILVPPTQSLPNGKKPNFGKSTKQRREPR
ERTSKTGHEDDKATMVTVNIDAFLHDKAPKKKSCKYKKKKTRQYQDRAAASIDSKPHVAG
HTAFAGASFTTDIPHEAALPKPSFV