Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER009W  from Saccharomyces cerevisiae S288C
>YER009W|YER009W NTF2 SGDID:S000000811, Chr V from 172115-172492, Genome Release 64-1-1, Verified ORF, "Nuclear envelope protein, interacts with GDP-bound Gsp1p and with proteins of the nuclear pore to transport Gsp1p into the nucleus where it is an essential player in nucleocytoplasmic transport" ORGANISM: Saccharomyces cerevisiae S288C (125 aa)
MSLDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQ
KVQHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFR
LNYSA