Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER007C-A  from Saccharomyces cerevisiae S288C
>YER007C-A|YER007C-A TMA20 SGDID:S000002957, Chr V from 166771-166237,166885-166875, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function that associates with ribosomes and has a putative RNA binding domain; interacts with Tma22p; null mutant exhibits translation defects; has homology to human oncogene MCT-1" ORGANISM: Saccharomyces cerevisiae S288C (181 aa)
MFKKFTREDVHSRSKVKSSIQRTLKAKLVKQYPKIEDVIDELIPKKSQIELIKCEDKIQL
YSVDGEVLFFQKFDELIPSLKLVHKFPEAYPTVQVDRGAIKFVLSGANIMCPGLTSAGAD
LPPAPGYEKGTIVVINAENKENALAIGELMMGTEEIKSVNKGHSIELIHHLGDPLWNFSV
E