Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL073C  from Saccharomyces cerevisiae S288C
>YEL073C|YEL073C YEL073C SGDID:S000000799, Chr V from 7553-7230, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; located adjacent to ARS503 and the telomere on the left arm of chromosome V; regulated by inositol/choline" ORGANISM: Saccharomyces cerevisiae S288C (107 aa)
MVNLANVLTNATAATLSAWSNTVPLETYFHFDEASGFGDYYLNVSVIWMNETLYETRIVP
AIINVREWLDHMEANDPSPSVTNPYETSGYYAFSTVVPVLMGNMKVA