Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL059C-A  from Saccharomyces cerevisiae S288C
>YEL059C-A|YEL059C-A SOM1 SGDID:S000002954, Chr V from 42624-42400, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the mitochondrial inner membrane peptidase, which is required for maturation of mitochondrial proteins of the intermembrane space; Som1p facilitates cleavage of a subset of substrates; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (74 aa)
MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK
SATNYEVTDTYTNS