Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL048C  from Saccharomyces cerevisiae S288C
>YEL048C|YEL048C TCA17 SGDID:S000000774, Chr V from 65167-64709, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of TRAPPII, a multimeric GEF involved in intra-Golgi and endosome-to-Golgi transport; promotes association of TRAPPII-specific subunits with the core complex; sedlin related; human Sedlin mutations cause SEDT, a skeletal disorder" ORGANISM: Saccharomyces cerevisiae S288C (152 aa)
MSLRPCFVSLIDESDKPILIYVPNEAENEMNDVLKYNVLSNISLDYFESALVEWHSLDSK
PLLKSIFQLEGVSVFAMLIKQTGLKIVIGFEQKSLSGADDEFEAINQIFETVRKIYIRVK
CNPLLVSGDEKSIIKSLERKFDELFISTEVEL