Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL044W  from Saccharomyces cerevisiae S288C
>YEL044W|YEL044W IES6 SGDID:S000000770, Chr V from 69757-70257, Genome Release 64-1-1, Verified ORF, "Protein that associates with the INO80 chromatin remodeling complex under low-salt conditions; human ortholog INO80C is a member of the human INO80 complex; implicated in DNA repair based on genetic interactions with RAD52 epistasis genes" ORGANISM: Saccharomyces cerevisiae S288C (166 aa)
MSGSRGNSSNSSVSNNSNNNNNNDGGDERLLFLRSVGERNEIGFPSRFKSAHYKKPTRRH
KSARQLISDENKRINALLTKANKAAESSTAARRLVPKATYFSVEAPPSIRPAKKYCDVTG
LKGFYKSPTNNIRYHNAEIYQLIVKPMAPGVDQEYLKLRGANFVLK