Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL039C  from Saccharomyces cerevisiae S288C
>YEL039C|YEL039C CYC7 SGDID:S000000765, Chr V from 79977-79636, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytochrome c isoform 2, expressed under hypoxic conditions; electron carrier of the mitochondrial intermembrane space that transfers electrons from ubiquinone-cytochrome c oxidoreductase to cytochrome c oxidase during cellular respiration" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTD
ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK