Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL035C  from Saccharomyces cerevisiae S288C
>YEL035C|YEL035C UTR5 SGDID:S000000761, Chr V from 85545-85045, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; transcription may be regulated by Gcr1p; essential for growth under standard (aerobic) conditions but not under anaerobic conditions" ORGANISM: Saccharomyces cerevisiae S288C (166 aa)
MSRYGKNLVHYIIVEHDDQRGQKPIDDDDEKNFYYHCSFTFETFFRATAFLLAPAVCAVR
EVPCRLTRTRYNATEYIEGYGWMISLQQGLGVAEFYRPWPLSVQLQRYTTPSRRSRFAVL
TPQRKCHQNEANGQDLSLLILLSRIYPLCSNTSQTRRVAARKGKLS