Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL034W  from Saccharomyces cerevisiae S288C
>YEL034W|YEL034W HYP2 SGDID:S000000760, Chr V from 85676-86149, Genome Release 64-1-1, Verified ORF, "Translation elongation factor eIF-5A that may function in translation initiation; similar to and functionally redundant with Anb1p; structural homolog of bacterial EF-P; undergoes an essential hypusination modification" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLV
AIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGEL
GDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD