Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL033W  from Saccharomyces cerevisiae S288C
>YEL033W|YEL033W MTC7 SGDID:S000000759, Chr V from 86179-86598, Genome Release 64-1-1, Uncharacterized ORF, "Predicted metabolic role based on network analysis derived from ChIP experiments, a large-scale deletion study and localization of transcription factor binding sites; null mutant is sensitive to temperature oscillation in a cdc13-1 mutant" ORGANISM: Saccharomyces cerevisiae S288C (139 aa)
MKKEKKTPTPLPSHHVLFAEPGFFLCNFFFVLLKHTQINPFFYFLFILLFIIYIAIIYFV
FIRISHFSFSLCRQCNSLGRMIFMCAYLPAASSRSVANPALPPQKKKKKKKKGTLRTGEV
EEQAKGNISFDLCGKQNFQ