Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL020W-A  from Saccharomyces cerevisiae S288C
>YEL020W-A|YEL020W-A TIM9 SGDID:S000007256, Chr V from 117211-117474, Genome Release 64-1-1, Verified ORF, "Essential protein of the mitochondrial intermembrane space, forms a complex with Tim10p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner membrane" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCS
EKFLKHSERVGQRFQEQNAALGQGLGR