Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL017C-A  from Saccharomyces cerevisiae S288C
>YEL017C-A|YEL017C-A PMP2 SGDID:S000002103, Chr V from 122929-122798, Genome Release 64-1-1, reverse complement, Verified ORF, "Proteolipid associated with plasma membrane H(+)-ATPase (Pma1p); regulates plasma membrane H(+)-ATPase activity; nearly identical to PMP1" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MLMSTLPGGVILVFILVGLACIAIISTIIYRKWQARQRGLQRF