Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YEL003W  from Saccharomyces cerevisiae S288C
>YEL003W|YEL003W GIM4 SGDID:S000000729, Chr V from 148176-148194,148283-148599, Genome Release 64-1-1, Verified ORF, "Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it" ORGANISM: Saccharomyces cerevisiae S288C (111 aa)
MEQRNNVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGAL
VESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQVVKN