Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR540C  from Saccharomyces cerevisiae S288C
>YDR540C|YDR540C IRC4 SGDID:S000002948, Chr IV from 1517675-1517136, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative protein of unknown function; null mutant displays increased levels of spontaneous Rad52p foci; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MREYTSKKELKEEIEKKYEKYDAEFETISESQKDEKVETVDRTPSENLSYQLGWVNLLLE
WEAKEIAGYNVETPAPGYKWNNLGGLYQSFYKKYGIYSIKEQRAKLREAVNEVYKWISTL
SDDELFQAGNRKWATTKAMWPVYKWIHINTVAPFTNFRGKIRKWKRLVPEEQRIKRRKI