Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR519W  from Saccharomyces cerevisiae S288C
>YDR519W|YDR519W FPR2 SGDID:S000002927, Chr IV from 1480425-1480832, Genome Release 64-1-1, Verified ORF, "Membrane-bound peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; expression pattern suggests possible involvement in ER protein trafficking" ORGANISM: Saccharomyces cerevisiae S288C (135 aa)
MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTV
FDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSA
DLVFDVELVDVKSAA