Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR511W  from Saccharomyces cerevisiae S288C
>YDR511W|YDR511W ACN9 SGDID:S000002919, Chr IV from 1470017-1470418, Genome Release 64-1-1, Verified ORF, "Protein of the mitochondrial intermembrane space, required for acetate utilization and gluconeogenesis; has orthologs in higher eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MNNKLIYRSVRFATHNSQLLLPPLVLYRRILRQHKLLPGPQREMGDQYVRNEFKLHKDID
NPLHIVGFLASWQDYLHMISNGKWKDATLSSETLEKLSPEQTVQLYELMKETQKLHQDNE
IESSKDVKRNNKD