Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR510W  from Saccharomyces cerevisiae S288C
>YDR510W|YDR510W SMT3 SGDID:S000002918, Chr IV from 1469400-1469705, Genome Release 64-1-1, Verified ORF, "Ubiquitin-like protein of the SUMO family, conjugated to lysine residues of target proteins; regulates chromatid cohesion, chromosome segregation, APC-mediated proteolysis, DNA replication and septin ring dynamics; phosphorylated at Ser2" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY