Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR504C  from Saccharomyces cerevisiae S288C
>YDR504C|YDR504C SPG3 SGDID:S000002912, Chr IV from 1456694-1456311, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein required for survival at high temperature during stationary phase; not required for growth on nonfermentable carbon sources" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MICYFLVVTINFLKEKTTICHYFVNIFSLFLFLFVFVFVFIFVYFFYVILFYRFCSLFTY
FPANSIWYYLSIINIFFPLCFFLYENFTGRNRRKCSLFCLTLIKITYTSPNHGFMVTGKE
KFEKLRD