Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR500C  from Saccharomyces cerevisiae S288C
>YDR500C|YDR500C RPL37B SGDID:S000002908, Chr IV from 1450457-1450198,1450853-1450847, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl37Ap and to rat L37 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (88 aa)
MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRSHNWAAKAKRRHTTG
TGRMRYLKHVSRRFKNGFQTGSAKATSA