Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR493W  from Saccharomyces cerevisiae S288C
>YDR493W|YDR493W MZM1 SGDID:S000002901, Chr IV from 1436217-1436588, Genome Release 64-1-1, Verified ORF, "Mitochondrial matrix protein with a role in maintaining the labile mitochondrial zinc pool; null mutant has a respiratory growth defect and an elevated frequency of mitochondrial genome loss; overexpression causes cell cycle delay or arrest" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MSTRTKALNAYRHGLRATRIAFRNDAEVLLAARAKMRSGMLCPPDPKLTTEDQIQHLEDV
AVFLRRNLVQGKKVDGSSTKEPRYHLNIHKDTELGDNETIADPTARVKTNLKARPFKCSD
KKQ