Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR486C  from Saccharomyces cerevisiae S288C
>YDR486C|YDR486C VPS60 SGDID:S000002894, Chr IV from 1428120-1427431, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic and vacuolar membrane protein involved in late endosome to vacuole transport; required for normal filament maturation during pseudohyphal growth; may function in targeting cargo proteins for degradation; interacts with Vta1p" ORGANISM: Saccharomyces cerevisiae S288C (229 aa)
MNRIFGYGNKKSHDQLLQESNQSMNQAQQSLSNRISQLDTQIAQLNFQLQNIQKNLQRSN
NKQPSLRKQALKILNKRKQLENMKDSLDSQSWSMTQAQLTNDNLQNTMITINALKQTNNA
MKAQYGKINIDKLQDMQDEMLDLIEQGDELQEVLAMNNNSGELDDISDAELDAELDALAQ
EDFTLPTSENSLGNDMPSYLLGANAPPAFIDEEPNLDTEDKNKALESAQ