Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR482C  from Saccharomyces cerevisiae S288C
>YDR482C|YDR482C CWC21 SGDID:S000002890, Chr IV from 1420838-1420431, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in RNA splicing by the spliceosome; component of a complex containing Cef1p; interacts genetically with ISY1 and BUD13; may bind RNA; has similarity to S. pombe Cwf21p" ORGANISM: Saccharomyces cerevisiae S288C (135 aa)
MSYNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASHDKASRPLAV
QKQIETHMEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNEWQEQQRMSSLY
TPRKARLTEEQHRHE