Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR471W  from Saccharomyces cerevisiae S288C
>YDR471W|YDR471W RPL27B SGDID:S000002879, Chr IV from 1401770-1401800,1402185-1402564, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Ap and has similarity to rat L27 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (136 aa)
MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPSKVTKKHGAK
KVAKRTKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETFEQPSQREEAKKVVKKAFEE
RHQAGKNQWFFSKLRF