Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR469W  from Saccharomyces cerevisiae S288C
>YDR469W|YDR469W SDC1 SGDID:S000002877, Chr IV from 1399015-1399542, Genome Release 64-1-1, Verified ORF, "Subunit of the COMPASS (Set1C) complex, which methylates lysine 4 of histone H3 and is required in chromatin silencing at telomeres; contains a Dpy-30 domain that mediates interaction with Bre2p; similar to C. elegans and human DPY-30" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MNESENSPQHNEVTVPMVEDTSSNADIPMEQIQREDNKNYDKHDNECFDMNGNHNNNSDN
LQFDSVPSSATKDLKNIKSVTNQNVKIEESSSTNSVIEESSEPKISKLENVNLAATVGGS
QTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNILKSGEKESNASK