Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR461C-A  from Saccharomyces cerevisiae S288C
>YDR461C-A|YDR461C-A YDR461C-A SGDID:S000087209, Chr IV from 1385766-1385524, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MDSGKSDINKHAYKETATPLPVDPPSYEETMKQDKEEVEADETTSSAHRDSFMRPVYTHH
PHPRSHKGYPGAKTLTYTSR