Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR450W  from Saccharomyces cerevisiae S288C
>YDR450W|YDR450W RPS18A SGDID:S000002858, Chr IV from 1359923-1359969,1360405-1360798, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MSLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKADVDLHKRAGE
LTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIR
AHRGIRHFWGLRVRGQHTKTTGRRRA