Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR447C  from Saccharomyces cerevisiae S288C
>YDR447C|YDR447C RPS17B SGDID:S000002855, Chr IV from 1355236-1354829,1355553-1355551, Genome Release 64-1-1, reverse complement, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Ap and has similarity to rat S17 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (136 aa)
MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKR
IQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSLGLKLPLS
VINVSAQRDRRYRKRN