Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR437W  from Saccharomyces cerevisiae S288C
>YDR437W|YDR437W GPI19 SGDID:S000002845, Chr IV from 1337352-1337774, Genome Release 64-1-1, Verified ORF, "Subunit of GPI-GlcNAc transferase involved in synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), which is the first intermediate in glycosylphosphatidylinositol (GPI) anchor synthesis, shares similarity with mammalian PIG-P" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MYTKEYYWFSQYMIITSTLVLTIIWSILPSSLGEAAPKQFINTLLDIFPQRRWIITLESI
MLMGMLCTYIGLLMYNEDTLTPPLDSLSTVTDAGGQLVIEDDPDVFVKKWAFKETSGIYD
LSLMDACQLLYLYDNDHTST