Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR424C  from Saccharomyces cerevisiae S288C
>YDR424C|YDR424C DYN2 SGDID:S000002832, Chr IV from 1319617-1319387,1319720-1319698,1319841-1319817, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic light chain dynein, microtubule motor protein; proposed to be involved in the assembly of the nuclear pore complex" ORGANISM: Saccharomyces cerevisiae S288C (92 aa)
MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVI
VGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA